MMP13

Functional Attributes in Pathways

Recent News and Literature

  1. Bone morphogenetic protein-2 enhances...Bone. 2008 Nov 6.
  2. [Relationship between the expression...Zhonghua Bing Li Xue Za Zhi. 2008 Jul;37(7):471-6.
  3. Experimental periodontitis in mice...J Periodontal Res. 2008 Oct 7.
  4. Leptin induces migration and invasion...Glia. 2008 Sep 23.
  5. No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
  6. Proteomic Analysis in Lung...Chest. 2008 Aug 27.
  7. MMP-13 is over-expressed in renal...Clin Exp Metastasis. 2008 Aug 16.
  8. Matrix metalloproteinase 13 is induced...PLoS ONE. 2008 Aug 13;3(8):e2959.
  9. Oct-3/4 expression reflects tumor...Cancer Res. 2008 Aug 1;68(15):6281-91.
  10. New pathway links from...J Cell Physiol. 2008 Jul 23.
  11. In vivo interstitial migration...J Immunol. 2008 Aug 1;181(3):2155-64.
  12. Steroid receptor coactivator-3/AIB1 promotes...Cancer Res. 2008 Jul 1;68(13):5460-8.
  13. Is collagenase-3 (MMP-13) expression...Diagn Pathol. 2008 Jun 13;3(1):26.
  14. Selective modulation of matrix...J Biol Chem. 2008 May 22;.
  15. CXCL12/CXCR4 promotes laryngeal and hypopharyngeal...Carcinogenesis. 2008 May 16;.
  16. Tumor-derived Matrix Metalloproteinase-13 (MMP-13)...BMC Cancer. 2008 Mar 28;8(1):83.
  17. Matrix metalloproteinase (MMP)-1, -9 and -13 as prognostic...Acta Otolaryngol. 2008 Apr;128(4):482-90.
  18. Expression pattern and circulating...Int J Cancer. 2008 Jun 15;122(12):2805-10.
  19. Transformation-specific matrix metalloproteinases (MMP)-7...Br J Dermatol. 2008 Apr;158(4):778-85. Epub 2008 Feb 16.
  20. Characterization of progressive periodontal...J Clin Periodontol. 2008 Mar;35(3):206-14.

Structural Features

MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVT

GKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGI

ADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM

FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAEL

FLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGN

QVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

Cross annotation in other databases

MMP13 in: