MMP7

Functional Attributes in Pathways

Recent News and Literature

  1. [Effects of angiotensin converting...Zhonghua Wei Chang Wai Ke Za Zhi. 2008 Nov;11(6):565-8.
  2. [DDP-sensitivity-related genes in 10 lung...Zhonghua Zhong Liu Za Zhi. 2008 Jun;30(6):418-21.
  3. Reck forms cowbell-shaped dimers...J Biol Chem. 2008 Nov 20.
  4. LPA receptor 2 mediates...Gynecol Oncol. 2008 Nov 17.
  5. Matrix metalloproteinase 7 is required...Lab Invest. 2008 Nov 10.
  6. [Effects of Tamoxifen on Apoptosis...Ai Zheng. 2008 Nov;27(11):1172-6.
  7. Study of matrix metalloproteinases...Histopathology. 2008 Oct;53(4):403-15.
  8. Enhanced systemic matrix metalloproteinase...Ann Med. 2008 Oct 31:1-8.
  9. Polymorphisms of matrix metalloproteinase-7...J Gastroenterol. 2008;43(10):751-61. Epub 2008 Oct 29.
  10. Identification of amino acid...J Biol Chem. 2008 Oct 27.
  11. Active matrix metalloproteinase-7 is associated...Mod Pathol. 2008 Oct 17.
  12. Enhanced expression of trophinin...J Cancer Res Clin Oncol. 2008 Oct 10.
  13. Predictive value of MMP-7...Cancer Sci. 2008 Sep 23.
  14. Genetic polymorphisms in the MMP-7...Int J Cancer. 2008 Sep 16.
  15. Wnt1 overexpression promotes tumour...Eur J Cancer. 2008 Nov;44(17):2680-8. Epub 2008 Sep 13.
  16. No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
  17. Matrilysin (MMP-7) Is a Novel...Clin Cancer Res. 2008 Sep 1;14(17):5503-5511.
  18. Diallyl trisulfide increases the effectiveness...Mol Cancer Ther. 2008 Aug;7(8):2328-38.
  19. HRCT and histopathological evaluation...Respir Med. 2008 Dec;102(12):1753-61. Epub 2008 Aug 23.
  20. Matrilysin (matrix metalloprotease-7) cleaves...FEBS J. 2008 Aug 20.

Structural Features

MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIE

IMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFAR

GAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD

PQNFKLSQDDIKGIQKLYGKRSNSRKK

Cross annotation in other databases

MMP7 in: