MMP14

Functional Attributes in Pathways

Recent News and Literature

  1. Aberrant activation of hedgehog...Carcinogenesis. 2008 Nov 20.
  2. Polarized MT1-MMP-CD44 interaction and CD44...Cell Motil Cytoskeleton. 2008 Nov 20.
  3. Overexpression of MT1-MMP is insufficient...Int J Mol Med. 2008 Dec;22(6):757-761.
  4. Membrane type 1 matrix...Cancer Res. 2008 Nov 15;68(22):9558-65.
  5. Direct visualization of protease...Matrix Biol. 2008 Oct 29.
  6. SCCRO (DCUN1D1) Induces Extracellular...Clin Cancer Res. 2008 Nov 1;14(21):6780-9.
  7. Activation of Matrix Metalloproteinase-2...Cancer Res. 2008 Nov 1;68(21):9096-104.
  8. Characterization of the transcriptional...Nephrol Dial Transplant. 2008 Oct 16.
  9. [Expression of MT1-MMP and its significance...Zhonghua Wai Ke Za Zhi. 2008 Apr 15;46(8):606-9.
  10. Secretion of active membrane...J Cell Biochem. 2008 Sep 18.
  11. Antitumor activity of a membrane...Mol Cancer Ther. 2008 Sep;7(9):2933-40.
  12. TLR ligand-induced podosome disassembly...J Cell Biol. 2008 Sep 1.
  13. HRCT and histopathological evaluation...Respir Med. 2008 Dec;102(12):1753-61. Epub 2008 Aug 23.
  14. Novel pathway compendium analysis...Bioinformatics. 2008 Oct 15;24(20):2384-90. Epub 2008 Aug 21.
  15. [Effect of bone morphogenetic...Zhong Nan Da Xue Xue Bao Yi Xue Ban. 2008 Jul;33(7):634-7.
  16. MT1-MMP regulates urothelial cell...Br J Cancer. 2008 Jul 29.
  17. A Large-Scale Study of MT1-MMP...Ann Surg Oncol. 2008 Jul 26.
  18. Impaired tyrosine phosphorylation of membrane-type...Carcinogenesis. 2008 Jul 10.
  19. Diverse roles of matrix...Neuroscience. 2008 Jun 19;.
  20. Mapping proteolytic cancer cell-extracellular...Clin Exp Metastasis. 2008 Jul 4.

Structural Features

MSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKA

DADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFR

EVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE

LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICD

GNFDTVAMLRGEMFVFKKRWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYP

KHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG

NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVF

FFRRHGTPRRLLYCQRSLLDKV

Cross annotation in other databases

MMP14 in: