MMP28

Functional Attributes in Pathways

Recent News and Literature

  1. Epilysin (MMP-28) - structure,...Exp Dermatol. 2008 Sep 18.
  2. Additional MDA-MB-231 breast cancer...J Cell Physiol. 2008 Aug;216(2):480-5.
  3. Functional role of matrix...Oral Oncol. 2006 Oct;42(9):907-13. Epub 2006 May 26.
  4. Comprehensive profiling and localisation...Br J Cancer. 2006 Feb 27;94(4):569-77.
  5. Differential expression of three...Dig Dis Sci 2004 Apr;49(4): p653-61
  6. Epilysin (MMP-28) expression is associated...J Invest Dermatol 2002 Jul;119(1): p14-21
  7. Characterization of matrix metalloproteinase-26,...Biochem J 2001 Jun 15;356(Pt 3): p705-18

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWVSQLPVSGVLDR

ATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRKKRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVRGAVRAAFQ

LWSNVSALEFWEAPATGPADIRLTFFQGDHNDGLGNAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAH

EIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQSLYGKPLGGSVAVQLPGKLFTDFETWDSYSPQGRRPETQG

PKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPK

PVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFF

RDDRYWCLDQAKLQATTSGRWATELPWMGCWHANSGSALF

Cross annotation in other databases

MMP28 in: