NAPA

Functional Attributes in Pathways

Recent News and Literature

  1. The aspartic protease napsin...Lab Invest. 2008 Mar;88(3):256-63. Epub 2008 Jan 14.
  2. Aspartic proteinase napsin is a useful...Br J Cancer 2003 Apr 22;88(8): p1229-33
  3. Human tissue distribution of TA02,...Jpn J Cancer Res 2000 Oct;91(10): p1015-21
  4. Selective growth arrest and phenotypic...J Clin Invest 1993 May;91(5): p2288-95

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MSPPPLLQPLLLLLPLLNVEPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVPLSNYRDVQYFG

EIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGI

KGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDP

AHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEI

PKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLAR

ARTRGADLGWGETAQAQFPG

Cross annotation in other databases

NAPA in: