MMP21

Functional Attributes in Pathways

Recent News and Literature

  1. No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
  2. Matrix Metalloproteinase-21 Expression Is Associated...J Invest Dermatol. 2008 Jul 17;.
  3. Additional MDA-MB-231 breast cancer...J Cell Physiol. 2008 Aug;216(2):480-5.
  4. Increased expression of matrix...Mod Pathol. 2007 Nov;20(11):1128-40. Epub 2007 Sep 14.
  5. MMP-21 is expressed by macrophages...Exp Dermatol. 2006 Oct;15(10):775-83.
  6. Matrix metalloproteinases 21 and 26 are differentially...Tumour Biol. 2006;27(3):133-41. Epub 2006 Apr 20.
  7. The matrix metalloproteinase-21 gene...Anticancer Res 2004 Jan-Feb;24(1): p199-201
  8. Matrix metalloproteinase-21 is expressed...Lab Invest 2003 Dec;83(12): p1887-99
  9. Matrix metalloproteinase-21, the human...Gene 2002 Nov 13;301(1-2): p31-41
  10. Characterization of matrix metalloproteinase-26,...Biochem J 2001 Jun 15;356(Pt 3): p705-18
  11. 72-kilodalton type IV collagenase,...Int J Gynecol Pathol 1996 Apr;15(2): p102-9

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRYGWSGVWAAWGPSPEGPPETP

KGAALAEAVRRFQRANALPASGELDAATLAAMNRPRCGVPDMRPPPPSAPPSPPGPPPRARSRRSPRAPLSLSRRGWQPR

GYPDGGAAQAFSKRTLSWRLLGEALSSQLSVADQRRIVALAFRMWSEVTPLDFREDLAAPGAAVDIKLGFGRGRHLGCPR

AFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDTGISLLKVAVHEIGHVLGLPHTYRTGSIMQPNYIPQEPAFELDWSDRK

AIQKLYGSCEGSFDTAFDWIRKERNQYGEVMVRFSTYFFRNSWYWLYENRNNRTRYGDPIQILTGWPGIPTHNIDAFVHI

WTWKRDERYFFQGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNR

VLNSYPKRITEVFPAVIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVNDKDKQQNSWLPANGLFPKKFISEKWFDVC

DVHISTLNM

Cross annotation in other databases

MMP21 in: