KLK11

Functional Attributes in Pathways

Recent News and Literature

  1. Kallikrein 11 expressed in...Int J Oncol. 2007 Jun;30(6):1493-8.
  2. Enzymatic properties of human...Biol Chem. 2007 Apr;388(4):427-35.
  3. Human tissue kallikreins: the...Cancer Lett. 2007 Apr 28;249(1):61-79. Epub 2007 Jan 31.
  4. mRNA expression analysis of...Biol Chem. 2006 Jun;387(6):789-93.
  5. Expression of the human...Biol Chem. 2006 Jun;387(6):783-8.
  6. Expression analysis and prognostic...Clin Chim Acta. 2005 Jul 24;357(2):190-5.
  7. Human kallikrein gene 11...Clin Cancer Res 2004 Apr 15;10(8): p2766-70
  8. Favorable prognostic value of...Int J Cancer 2003 Sep 10;106(4): p605-10
  9. Quantitative analysis of hippostasin/KLK11...Urology 2003 May;61(5): p1042-6
  10. Molecular cloning and expression...Prostate 2003 Mar 1;54(4): p299-305
  11. Alternative splicing isoforms of...Prostate 2001 Sep 15;49(1): p72-8

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKE

EGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHT

LRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYV

DWIQETMKNN

Cross annotation in other databases

KLK11 in: