KLK12

Functional Attributes in Pathways

Recent News and Literature

  1. Human kallikrein-related peptidase 12:...Prostate. 2007 Sep 15;67(13):1465-74.
  2. Enzymatic properties of human...Biol Chem. 2007 Apr;388(4):427-35.
  3. Splice-site genetic polymorphism of...Hum Mutat 2004 Sep;24(3): p273-4
  4. KLK12 is a novel...Genomics 2000 Nov 1;69(3): p331-41

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQL

DWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQ

CLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDW

IRMIMRNN

Cross annotation in other databases

KLK12 in: