Caspase 8

Functional Attributes in Pathways

Recent News and Literature

  1. Quercetin sensitizes human hepatoma...J Cell Biochem. 2008 Nov 3.
  2. Polyporenic acid C induces...Mol Carcinog. 2008 Oct 30.
  3. FADD and caspase-8 control...Proc Natl Acad Sci U S A. 2008 Oct 22.
  4. c-FLIP knockdown induces ligand-independent...Biochem Pharmacol. 2008 Sep 17.
  5. Combined inhibition of FLIP...Oncogene. 2008 Sep 29.
  6. Simultaneous downregulation of uPAR...Int J Oncol. 2008 Oct;33(4):783-90.
  7. Inhibition of fatty acid...J Biol Chem. 2008 Sep 16.
  8. Regulation of Apoptosis and Caspase-8...Cancer Res. 2008 Sep 15;68(18):7352-61.
  9. Interleukin-8 signaling attenuates TRAIL-...Mol Cancer Ther. 2008 Sep;7(9):2649-61.
  10. Mitogen-activated protein kinase kinase...Mol Cancer Ther. 2008 Sep;7(9):2633-48.
  11. Vorinostat and sorafenib increase...Cancer Biol Ther. 2008 Oct 12;7(10).
  12. Vorinostat and Sorafenib Synergistically...Clin Cancer Res. 2008 Sep 1;14(17):5385-5399.
  13. Blockade of processing/activation of caspase-3...Biochem Biophys Res Commun. 2008 Aug 28.
  14. Diallyl trisulfide increases the effectiveness...Mol Cancer Ther. 2008 Aug;7(8):2328-38.
  15. FLIP-ping out: Death receptor...Cancer Biol Ther. 2008 Aug 1;7(8).
  16. Clinicopathological Significance of Caspase-8...Oncology. 2008 Aug 21;74(3-4):229-236.
  17. A tumour suppressor function...Cell Death Differ. 2008 Sep;15(9):1337-8.
  18. MUC1 oncoprotein blocks death...Cancer Res. 2008 Aug 1;68(15):6136-44.
  19. Leukocyte Elastase Inhibitor, the precursor...Biochim Biophys Acta. 2008 Jul 8.
  20. Sanguinarine, a benzophenanthridine alkaloid,...Chemotherapy. 2008;54(4):279-87. Epub 2008 Jul 31.

Structural Features

MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLN

TRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDIL

KRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIIN

NHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDK

GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFL

LGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD

Cross annotation in other databases

Caspase 8 in: