Caspase 9

Functional Attributes in Pathways

Recent News and Literature

  1. Polyporenic acid C induces...Mol Carcinog. 2008 Oct 30.
  2. c-FLIP knockdown induces ligand-independent...Biochem Pharmacol. 2008 Sep 17.
  3. Immunohistochemical localization of caspase-3,...J Mol Histol. 2008 Sep 24.
  4. Simultaneous downregulation of uPAR...Int J Oncol. 2008 Oct;33(4):783-90.
  5. Comedo-ductal carcinoma in situ:...Cancer Biol Ther. 2008 Nov 12;7(11).
  6. Vorinostat and Sorafenib Synergistically...Clin Cancer Res. 2008 Sep 1;14(17):5385-5399.
  7. Caspase-2 functions upstream of mitochondria...Mol Cancer Ther. 2008 Aug;7(8):2298-307.
  8. A novel dynamic matrix...Cancer Lett. 2008 Aug 22.
  9. Sanguinarine, a benzophenanthridine alkaloid,...Chemotherapy. 2008;54(4):279-87. Epub 2008 Jul 31.
  10. PRIMA-1(MET) induces mitochondrial apoptosis...Oncogene. 2008 Jul 28.
  11. Japanese encephalitis virus infection...J Gen Virol. 2008 Aug;89(Pt 8):1930-41.
  12. ATR-dependent activation of p38 MAP kinase...J Biol Chem. 2008 Sep 12;283(37):25171-7. Epub 2008 Jul 14.
  13. Mitochondria-cytochrome C-caspase-9 cascade mediates...Cancer Lett. 2008 Jul 8;.
  14. Chemosensitisation by manganese superoxide...Br J Cancer. 2008 Jul 1;.
  15. BCL-X(L) regulates TNF-alpha-mediated cell...Cell Res. 2008 Jul 1;.
  16. Emodin azide methyl anthraquinone...Mol Cancer Ther. 2008 Jun;7(6):1688-97.
  17. Parcs is a dual...J Biol Chem. 2008 Sep 5;283(36):24400-5. Epub 2008 Jun 18.
  18. 2-Chloro-2'-deoxyadenosine-induced apoptosis in T leukemia...Int J Oncol. 2008 Jun;32(6):1325-33.
  19. Gamma irradiation of human...Int J Radiat Biol. 2008 Jun;84(6):523-30.
  20. Phosphorylation of murine caspase-9...J Biol Chem. 2008 Jul 18;283(29):20149-58. Epub 2008 May 8.

Structural Features

MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDT

GQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPC

GHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ

ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQ

EGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQM

PGCFNFLRKKLFFKTS

Cross annotation in other databases

Caspase 9 in: