Caspase 7

Functional Attributes in Pathways

Recent News and Literature

  1. Assessment of Apoptosis by Immunohistochemistry...J Histochem Cytochem. 2008 Nov 24.
  2. Inactivation of the Human...Endocrinology. 2008 Oct 1.
  3. Tumor suppressor effect of follistatin-like...Carcinogenesis. 2008 Sep 16.
  4. Bcl2L12-mediated inhibition of effector...Proc Natl Acad Sci U S A. 2008 Jul 31.
  5. Matrix metalloproteinase-9 Inhibition Down-Regulates...Clin Cancer Res. 2008 Jun 1;14(11):3617-26.
  6. Apoptotic Cell Death in TrkA-overexpressing...Mol Cells. 2008 May 20;26(1).
  7. Differential cleavage of Mst1...Cell Signal. 2008 Jan 11;.
  8. Inhibition of ERK attenuates...J Cell Mol Med. 2008 Aug;12(4):1265-71. Epub 2008 Feb 8.
  9. Survivin and Caspase-3 Expression...Appl Immunohistochem Mol Morphol. 2008 Jan 25;.
  10. Efficacy of sulforaphane is mediated...Eur J Cancer Prev. 2007 Dec;16(6):505-10.
  11. Plasminogen structural domains exhibit...J Biol Chem. 2007 Nov 9;282(45):32811-20. Epub 2007 Sep 11.
  12. Induction of apoptosis by immature...Int J Food Sci Nutr. 2007 Feb;58(1):42-53.
  13. Leukotriene B4 receptor antagonist...Anticancer Drugs. 2007 Jun;18(5):535-41.
  14. Relationship between subcellular localisation...Br J Cancer. 2007 Mar 26;96(6):944-51. Epub 2007 Feb 27.
  15. Black tea polyphenols restrict...Asian Pac J Cancer Prev. 2006 Oct-Dec;7(4):661-6.
  16. Targeted inhibition of the extracellular...Mol Cancer Ther. 2007 Jan;6(1):138-46.
  17. Antitumor activity of novel...Clin Cancer Res. 2007 Jan 1;13(1):253-9.
  18. 5-FdUrd-araC heterodinucleoside re-establishes sensitivity...Differentiation. 2006 Dec;74(9-10):488-98.
  19. [Study on apoptosis of oral...Ai Zheng. 2006 Aug;25(8):933-40.
  20. Caspase-mediated cleavage of ATM during...Am J Physiol Renal Physiol. 2006 Dec;291(6):F1300-7. Epub 2006 Jul 18.

Structural Features

MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDK

VTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIK

DLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW

FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Cross annotation in other databases

Caspase 7 in: