KLK14

Recent News and Literature

  1. High Expression of KLK14...Tumour Biol. 2008;29(1):1-8. Epub 2008 May 23.
  2. Expression and enzymatic characterization...Zoolog Sci. 2007 Aug;24(8):774-80.
  3. Defining the extended substrate...Biol Chem. 2007 Nov;388(11):1215-25.
  4. Expression and functional characterization...J Biol Chem. 2007 Jan 26;282(4):2405-22. Epub 2006 Nov 16.
  5. Enzymatic profiling of human...Biol Chem 2005 Mar;386(3): p291-8
  6. Human kallikrein 14: a...Cancer Res 2003 Dec 15;63(24): p9032-41
  7. Human tissue kallikreins and...APMIS 2003 Jan;111(1): p225-32; discussion 232-3
  8. Cloning of a new...Cancer Res 2001 Apr 15;61(8): p3425-31

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKH

NLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPA

SLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKY

RSWIEETMRDK

Cross annotation in other databases

KLK14 in: