MMP17

Functional Attributes in Pathways

Recent News and Literature

  1. MT4-(MMP17) and MT6-MMP (MMP25),...Cancer Metastasis Rev. 2008 Feb 20;.
  2. Establishment of an MT4-MMP-deficient...Genes Cells. 2007 Sep;12(9):1091-100.
  3. Membrane-type 4 matrix metalloproteinase...Cancer Res. 2006 May 15;66(10):5165-72.
  4. Homophilic complex formation of MT1-MMP...EMBO J 2001 Sep 3;20(17): p4782-93
  5. Matrix-dependent proteolysis of surface...J Biol Chem 2001 May 25;276(21): p18415-22
  6. Membrane type 4 matrix...J Biol Chem 2000 May 12;275(19): p14046-55
  7. Catalytic activities and substrate...J Biol Chem 1999 Nov 12;274(46): p33043-9
  8. Human membrane type-4 matrix...FEBS Lett 1999 Sep 3;457(3): p353-6
  9. Immunological characterization of cell-surface...Mol Carcinog 1998 Jun;22(2): p84-94
  10. Implication of collagen type...Lab Invest 1997 May;76(5): p651-60
  11. Expression and tissue localization...Cancer Res. 1997 May 15;57(10):2055-60.
  12. Molecular cloning of a novel...Cancer Res 1996 Mar 1;56(5): p944-9

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MRRRAARGPGPPPPGPGLSRLPLLPLPLLLLLALGTRGGCAAPAPAPRAEDLSLGVEWLSRFGYLPPADPTTGQLQTQEE

LSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVR

ALMYYALKVWSDIAPLNFHEVAGSTADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDA

HGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPPD

NRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKI

VFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPS

TLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDG

YEVCSCTSGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQALTL

Cross annotation in other databases

MMP17 in: