Caspase 10

Functional Attributes in Pathways

Recent News and Literature

  1. Clinicopathological Significance of Caspase-8...Oncology. 2008 Aug 21;74(3-4):229-236.
  2. Genetic variants and haplotypes...Hum Mutat. 2008 Jun 18;.
  3. Matrix metalloproteinase-9 Inhibition Down-Regulates...Clin Cancer Res. 2008 Jun 1;14(11):3617-26.
  4. The important role of caspase-10...Kobe J Med Sci. 2007;53(5):265-73.
  5. The Amaryllidaceae isocarbostyril narciclasine...Neoplasia. 2007 Sep;9(9):766-76.
  6. Apaf-1 and caspase-9 deficiency...Blood. 2007 Nov 15;110(10):3662-72. Epub 2007 Jul 25.
  7. HDAC inhibitors induce apoptosis...Int J Biochem Cell Biol. 2007 Mar 15;.
  8. Blockade of death receptor-mediated...J Invest Dermatol. 2007 Oct;127(10):2425-37. Epub 2007 May 10.
  9. Caspase-10 involvement in cytotoxic...Oncogene. 2006 Dec 7;25(58):7635-45. Epub 2006 Jun 12.
  10. In vitro and in vivo...Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3485-93.
  11. Bis(2-hydroxybenzylidene)acetone, a potent inducer...Cancer Lett. 2007 Jan 8;245(1-2):341-9. Epub 2006 Mar 6.
  12. Bovine herpesvirus 4 induces...Cancer Res. 2005 Oct 15;65(20):9463-72.
  13. Taxol induces caspase-10-dependent apoptosis....J Biol Chem 2004 Dec 3;279(49): p51057-67
  14. E-Cadherin (CDH1) and p53 rather...Eur J Cancer. 2004 Aug;40(12):1897-903.
  15. Caspase-mediated Cleavage of Insulin...J Biol Chem 2004 Jun 11;279(24): p25149-56
  16. Lactacystin, a proteasome inhibitor,...Anticancer Res 2002 Nov-Dec;22(6C): p3805-9
  17. Profiling of differentially expressed...World J Gastroenterol. 2002 Aug;8(4):580-5.
  18. Inactivating mutations of CASP10...Blood 2002 Jun 1;99(11): p4094-9
  19. Caspase-10 is an initiator...Proc Natl Acad Sci U S A. 2001 Nov 20;98(24):13884-8.
  20. Death receptor recruitment of endogenous...J Biol Chem 2001 Dec 7;276(49): p46639-46

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLA

ELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQG

KIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSN

GNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFT

VHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQA

CQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKT

MEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS

Cross annotation in other databases

Caspase 10 in: