Caspase 5

Functional Attributes in Pathways

Recent News and Literature

  1. Mutational analysis of caspase...Hum Pathol. 2008 Apr 18;.
  2. Tumor necrosis factor-alpha-induced caspase-1...FEBS J. 2007 Sep;274(17):4396-407.
  3. Somatic mutation of the Caspase-5...Int J Mol Med. 2003 Oct;12(4):443-6.
  4. Anticancer mechanisms of 1-(3-C-ethynyl-beta-D-ribo-pentofuranosyl)...Nucleic Acids Res Suppl 2002;(2): p241-2
  5. Tumor necrosis factor-related apoptosis...Cytokine 2001 Aug 7;15(3): p166-70
  6. Altered expression of several...Eur J Cancer 2001 Aug;37(12): p1554-61
  7. Frameshift mutations at mononucleotide...Cancer Res. 1999 Jun 15;59(12):2995-3002.

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDVLHGVFNYLAKHDVLTLK

EEEKKKYYDAKIEDKALILVDSLRKNRVAHQMFTQTLLNMDQKITSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCK

KNHDEIYPIKKREDRRRLALIICNTKFDHLPARNGAHYDIVGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKS

SDSTFLVLMSHGILEGICGTAHKKKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLAVIS

SQSSENLEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQM

PTIERATLTRDFYLFPGN

Cross annotation in other databases

Caspase 5 in: