chymotrypsin C

Functional Attributes in Pathways

Recent News and Literature

  1. Structural analysis of covalently... Biochemistry 1987 Apr 21;26(8): p2364-73

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MLGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLKNDTWRHTCGGTLIASNFVLTAAHCISNTR

TYRVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVACLPEKDSLLPKDYPCYVTGW

GRLWTNGPIADKLQQGLQPVVDHATCSRIDWWGFRVKKTMVCAGGDGVISACNGDSGGPLNCQLENGSWEVFGIVSFGSR

RGCNTRKKPVVYTRVSAYIDWINEKMQL

Cross annotation in other databases

chymotrypsin C in: