proteasome alpha 5

Functional Attributes in Pathways

Recent News and Literature

    We currently do not have custom news for this protein.

Structural Features

MFLTRSEYDRGVNTFSPEGRLFQVEYDIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSG

LIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG

TFVQCDARAIGSASEGAQSSLQELYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD

I

Cross annotation in other databases

proteasome alpha 5 in: