trypsin C

Functional Attributes in Pathways

Recent News and Literature

  1. [Laboratory diagnosis of pancreatitis... Vrach Delo 1989 Jul;(7): p42-4

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MNPLLILAFVGAAVAVPFDDDDKIVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYKPHIQVRLGEHNIEV

LEGNEQFINAAKIIRHPKYNRITLNNDIMLIKLSTPAVINAHVSTISLPTAPPAAGTECLISGWGNTLSSGADYPDELQC

LDAPVLTQAKCKASYPLKITSKMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKRRPGVYTKVYNYVDWIK

DTIAANS

Cross annotation in other databases

trypsin C in: