KLK2

Functional Attributes in Pathways

Recent News and Literature

  1. Activation of hepatocyte growth...FEBS J. 2008 Mar;275(5):1003-17. Epub 2008 Jan 25.
  2. PSA and other tissue...Eur J Cancer. 2007 Sep;43(13):1918-26. Epub 2007 Aug 3.
  3. [Molecular forms of PSA]...Prog Urol. 2007 Apr;17(2):165-71.
  4. Activity and stability of...J Pept Sci. 2007 May;13(5):348-53.
  5. Human tissue kallikreins: the...Cancer Lett. 2007 Apr 28;249(1):61-79. Epub 2007 Jan 31.
  6. Long-term prediction of prostate...J Clin Oncol. 2007 Feb 1;25(4):431-6.
  7. Is there an inter-relationship...Steroids. 2007 Apr;72(4):335-41. Epub 2006 Dec 19.
  8. Variants of the hK2...Clin Cancer Res. 2006 Nov 1;12(21):6452-8.
  9. Free and total human...Urology. 2006 Jul;68(1):219-25.
  10. mRNA expression analysis of...Biol Chem. 2006 Jun;387(6):789-93.
  11. The role of kallikrein-related...Biol Chem. 2006 Jun;387(6):707-14.
  12. Identification of genes targeted...Oncogene. 2006 Nov 23;25(55):7311-23. Epub 2006 Jun 5.
  13. Mutant recombinant serpins as...FEBS J. 2006 Jun;273(11):2505-14.
  14. Novel peptide inhibitors of...J Biol Chem. 2006 May 5;281(18):12555-60. Epub 2006 Mar 9.
  15. High-speed biomarker identification utilizing...Electrophoresis 2006 Mar;27(5-6): p1093-103
  16. Prostate specific antigen isoforms...J Urol 2006 Jan;175(1): p104-7
  17. The use of genetic...Clin Cancer Res. 2005 Dec 1;11(23):8391-7.
  18. Pharmacokinetics, biodistribution, and antitumor...Prostate 2006 Mar 1;66(4): p358-68
  19. Kallikrein 4 (hK4) and...Endocr Relat Cancer 2005 Sep;12(3): p631-43
  20. Risk assessment for biochemical...Int J Cancer 2006 Mar 1;118(5): p1234-40

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNL

FEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSI

EPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKP

AVYTKVVHYRKWIKDTIAANP

Cross annotation in other databases

KLK2 in: