KLK15

Functional Attributes in Pathways

Recent News and Literature

  1. Development of an immunofluorometric...Clin Biochem. 2007 Jan;40(1-2):104-10. Epub 2006 Aug 25.
  2. Overexpression of the human...Biol Chem. 2006 Jun;387(6):807-11.
  3. Quantitative reverse transcription-PCR assay...Clin Chem. 2006 Jun;52(6):1070-9. Epub 2006 Apr 20.
  4. Human tissue kallikrein gene...Cancer Lett 2005 Jun 16;224(1): p1-22
  5. Intron retention: a common...Clin Chem 2005 Mar;51(3): p506-15
  6. Molecular cloning of the...J Biol Chem 2001 Jan 5;276(1): p53-61

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MWLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRVRLGEHNLRKR

DGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQ

VSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYT

KVCHYLEWIRETMKRN

Cross annotation in other databases

KLK15 in: