MMP24

Functional Attributes in Pathways

Recent News and Literature

  1. Immunoscreening of a cutaneous...Cancer Immunol Immunother. 2007 Jun;56(6):783-95. Epub 2006 Nov 7.
  2. Threonine 98, the pivotal...J Biol Chem 2004 Apr 23;279(17): p17562-9
  3. Direct activation of pro-matrix...Cancer Res 2003 Oct 15;63(20): p6758-62
  4. Endothelial tubulogenesis within fibrin...J Cell Sci 2002 Sep 1;115(Pt 17): p3427-38
  5. Identification and characterization of human...Cancer Res 1999 Jun 1;59(11): p2570-6

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAGNRAAVAVAVARADEAEAPFA

GQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTG

QKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGG

FLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQ

GIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDR

WFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTAL

RWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPR

NILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRP

VQEWV

Cross annotation in other databases

MMP24 in: