KLK8

Recent News and Literature

    We currently do not have custom news for this protein.

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYT

VRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTV

TSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPG

VYTNICRYLDWIKKIIGSKG

Cross annotation in other databases

KLK8 in: