KLK9

Functional Attributes in Pathways

Recent News and Literature

  1. Human tissue kallikrein 9:... Biol Chem. 2006 Jun;387(6):733-40.

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRKPYLWVRLGEHHLWK

WEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPV

TLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHY

LDWIQEIMEN

Cross annotation in other databases

KLK9 in: