KLK13

Recent News and Literature

  1. Defining the extended substrate...Biol Chem. 2007 Nov;388(11):1215-25.
  2. Human kallikrein 13 involvement...Biochem Biophys Res Commun 2004 Oct 22;323(3): p1084-90
  3. Human kallikrein 13 protein...J Clin Oncol. 2004 Feb 15;22(4):678-85.
  4. Human tissue kallikreins and...APMIS 2003 Jan;111(1): p225-32; discussion 232-3
  5. Human kallikrein gene 13...Br J Cancer 2002 May 6;86(9): p1457-64
  6. Identification and molecular characterization...Anticancer Res 2001 Sep-Oct;21(5): p3147-52

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLLCGGVLVHPKWVLTAAHCLKE

GLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTTCRVS

GWGTTTSPQVNYPKTLQCANIQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCG

QPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ

Cross annotation in other databases

KLK13 in: