presenilin 1

Recent News and Literature

  1. A secreted type of...FASEB J. 2006 Dec;20(14):2451-9.
  2. Lack of association between...Neurosci Lett 2005 Jul 1-8;382(1-2): p93-5
  3. Growth hormone receptor is...J Biol Chem 2005 May 13;280(19): p19331-42
  4. Gonadotropin-induced gene regulation in...Int J Oncol. 2004 May;24(5):1325-38.
  5. Loss of presenilin 1...Proc Natl Acad Sci U S A 2001 Sep 11;98(19): p10863-8

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAK

HVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK

VIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY

LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAEST

ERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA

SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI

Cross annotation in other databases

presenilin 1 in: