cathepsin W

Functional Attributes in Pathways

Recent News and Literature

  1. Microarray analysis of gene...Respirology. 2006 Sep;11(5):557-65.
  2. Molecular cloning and structural...J Biol Chem 1999 May 14;274(20): p13800-9

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MALTAHPSCLLALLVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEED

LGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAG

NIETLWRISFWDFVDVSVHELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDF

IMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQP

PHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLTARVQKPDMKPRVSCPP

Cross annotation in other databases

cathepsin W in: