elastase-1

Recent News and Literature

    We currently do not have custom news for this protein.

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNL

SQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLA

QTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSLHGVTSFVSSRGCNVSRKPTV

FTQVSAYISWINNVIASN

Cross annotation in other databases

elastase-1 in: