Caspase 14

Functional Attributes in Pathways

Recent News and Literature

  1. 2-DE analysis of a new human...Proteomics. 2007 May;7(9):1549-59.
  2. Expression profiling of apoptosis-related...APMIS. 2006 Jul-Aug;114(7-8):508-17.
  3. CDDO-Imidazolide inhibits growth and survival...Mol Cancer. 2006 Jun 7;5:22.
  4. Tumor-associated alterations in caspase-14...Clin Cancer Res 2005 Aug 1;11(15): p5462-71
  5. SAGE profiling of UV-induced...Mol Carcinog 2005 Jan;42(1): p40-52

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEKFQQAIDSREDPVS

CAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPGETVGGDEIVMVIKDSPQTIP

TYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY

LQ

Cross annotation in other databases

Caspase 14 in: