MMP26

Recent News and Literature

  1. Additional MDA-MB-231 breast cancer...J Cell Physiol. 2008 Aug;216(2):480-5.
  2. Expression of MMP-9, MMP-10...J Cutan Pathol. 2007 Dec;34(12):889-98.
  3. Increased expression of matrix...Mod Pathol. 2007 Nov;20(11):1128-40. Epub 2007 Sep 14.
  4. Calcium regulates tertiary structure...Biochem J. 2007 Apr 1;403(1):31-42.
  5. Expression of matrix metalloproteinase-26...Int J Gynecol Cancer. 2006 Sep-Oct;16(5):1794-800.
  6. MMP-21 is expressed by macrophages...Exp Dermatol. 2006 Oct;15(10):775-83.
  7. Peaking of MMP-26 and TIMP-4...Cell Res. 2006 Sep;16(9):741.
  8. Coordinated peak expression of MMP-26...Cell Res. 2006 Sep;16(9):750-8.
  9. Oxytocin induces proliferation and migration...Mol Cancer Res. 2006 Jun;4(6):351-9.
  10. Matrix metalloproteinases 21 and 26 are differentially...Tumour Biol. 2006;27(3):133-41. Epub 2006 Apr 20.
  11. Matrix metalloproteinase 26 proteolysis...Cancer Res 2006 Mar 1;66(5): p2716-24
  12. Matrilysin-2 (matrix metalloproteinase-26) is upregulated...J Invest Dermatol 2005 Apr;124(4): p849-56
  13. Matrix metalloproteinase-26 is associated...Cancer Res 2004 Dec 1;64(23): p8657-65
  14. Matrix metalloproteinase-26 (matrilysin-2) expression...Gynecol Oncol 2004 Sep;94(3): p661-70
  15. MRP-1/CD9 gene transduction downregulates...Oncogene 2004 Sep 30;23(45): p7475-83
  16. Association of matrilysin-2 (MMP-26)...Carcinogenesis 2004 Dec;25(12): p2353-60
  17. Differential expression of three...Dig Dis Sci 2004 Apr;49(4): p653-61
  18. Endometase/matrilysin-2 in human breast...Cancer Res 2004 Jan 15;64(2): p590-8
  19. Differential expression of matrilysin-1...J Pathol 2004 Jan;202(1): p14-22
  20. Expression of matrix metalloproteinase-26...Gynecol Oncol 2003 Jun;89(3): p453-9

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQP

HCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHED

GWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL

SADDIQRIQHLYGEKCSSDIP

Cross annotation in other databases

MMP26 in: