MMP25

Recent News and Literature

  1. Identification and role of the homodimerization...J Biol Chem. 2008 Oct 20.
  2. MT4-(MMP17) and MT6-MMP (MMP25),...Cancer Metastasis Rev. 2008 Feb 20;.
  3. MMP25 (MT6-MMP) is highly...J Biol Chem. 2007 Jul 27;282(30):21998-2010. Epub 2007 May 18.
  4. Complete restoration of cell...J Biol Chem. 2007 Mar 2;282(9):6438-43. Epub 2006 Dec 11.
  5. The hemopexin domain of membrane-type...J Biol Chem 2004 Dec 3;279(49): p51148-55
  6. Direct activation of pro-matrix...Cancer Res 2003 Oct 15;63(20): p6758-62
  7. Human MT6-matrix metalloproteinase: identification,...Cancer Res 2000 Feb 15;60(4): p877-82

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRDAIKVMQRFAGLPETGRMDPG

TVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEV

DSPQGQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALG

LGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQPPASPTHSPSFPIPDRCEGN

FDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEG

GARPLTELGLPPGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKG

AHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAAGRWPAPIPLLLLPLLVGGVA

SR

Cross annotation in other databases

MMP25 in: