MMP20

Recent News and Literature

  1. Additional MDA-MB-231 breast cancer...J Cell Physiol. 2008 Aug;216(2):480-5.
  2. Expression of collagen XVIII...Matrix Biol 2004 Jun;23(3): p153-61
  3. mRNA expression and phenotype...Arch Oral Biol 2003 Dec;48(12): p843-50
  4. Expression and regulation of MMP-20...J Dent Res 2001 Oct;80(10): p1884-9
  5. Analysis of 16 different...Ann Rheum Dis. 1999 Nov;58(11):691-7.

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIRKIKELQAFFG

LQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRI

NSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNPEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDP

SALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIF

WRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYL

REPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSW

IGC

Cross annotation in other databases

MMP20 in: